PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01031333001
Common NameLOC100254549, VIT_14s0060g00300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 237aa    MW: 26716.7 Da    PI: 10.0735
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01031333001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.23.7e-171150342
                       --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
             SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                       i n+s r+ tf kR++g++KK +ELS+LC+++++ i++s+
  GSVIVT01031333001 11 ITNDSARKATFKKRKKGLMKKVSELSTLCGIDACAILYSP 50
                       89************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.722149IPR002100Transcription factor, MADS-box
SMARTSM004321.9E-24160IPR002100Transcription factor, MADS-box
CDDcd002661.13E-23285No hitNo description
SuperFamilySSF554551.16E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-8323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MTRKKVKLAY ITNDSARKAT FKKRKKGLMK KVSELSTLCG IDACAILYSP YDSQPEVWPS  60
PLGVQRVLAH FKKMPEMEQS KKMVNQESFL RQRIAKGNEQ LKKQRKDNRE KEITQVMYQS  120
LTGKGLQNLN IVDLNDLGWM IDQNLKDIHK RIESLNKEAQ SQAAAAAAAA AGQLIKTGGK  180
AQEEKPAFDS MDAIQRQQWF VDLVNPNEQM GFAGDDMMLP FGDNNHNALW PNGFFP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYITNDSARKATFKKRK
22125KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4619490.0AM461949.2 Vitis vinifera contig VV78X127711.9, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279507.11e-177PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK39e-71AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLD7UAA81e-177D7UAA8_VITVI; Putative uncharacterized protein
STRINGVIT_14s0060g00300.t011e-177(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-70AGAMOUS-like 80